A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10086 |
Swiss-prot Accession number | P01221 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain 1 precursor (Gonadotropin alphachain 1) (GTH-alpha). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 118 Amino acids |
Molecular weight | 13533 |
References | 1 PubMed abstract 3246480 2 PubMed abstract 1370380 3 PubMed abstract 607993 |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain 1 |
Mature Hormone Sequence | YPRNDMNNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 95 Residues from position (24-118) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10164 |
Swiss-prot Accession number | Q5KT11 (Sequence in FASTA format) |
Description | Thyroliberin precursor [Contains: Prothyroliberin; Thyroliberin(Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor)(TRF) (TSH-releasing factor) (Protirelin)]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the TRH family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems |
Protein Length | 187 Amino acids |
Molecular weight | 21286 |
References | 1 PubMed abstract 15707606 |
Domain Name | TRH |
Hormone Name | Thyroliberin |
Mature Hormone Sequence | QHP |
Position of mature hormone in Pre-Hormone protein | 3 Residues from position (65-67) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10243 |
Swiss-prot Accession number | Q9I955 (Sequence in FASTA format) |
Description | Thymosin beta-a. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 46 Amino acids |
Molecular weight | 5194 |
References | 1 Fujiki K., Nakao M., Shin D., Yano T.; "Molecular cloning of carp (Cyprinus carpio) thymosin beta a."; Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta-a |
Mature Hormone Sequence | SDNPVKEEVQQFDKKCLKKTNTAEKNTLPTKEDIDQEKKAAEGGK |
Position of mature hormone in Pre-Hormone protein | 45 Residues from position (2-46) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10244 |
Swiss-prot Accession number | Q9I954 (Sequence in FASTA format) |
Description | Thymosin beta-b. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 43 Amino acids |
Molecular weight | 4970 |
References | 1 Fujiki K., Nakao M., Shin D., Yano T.; "Molecular cloning of carp (Cyprinus carpio) thymosin beta b."; Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta-b |
Mature Hormone Sequence | ADKPDISEVSQFDKTKLKKTETQEKNTLPTKETIEQEKQCEA |
Position of mature hormone in Pre-Hormone protein | 42 Residues from position (2-43) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10377 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (190-222) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10378 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Met-enkephalin |
Mature Hormone Sequence | YGGFM |
Position of mature hormone in Pre-Hormone protein | 5 Residues from position (190-194) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10379 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPVGRKRRPIKVYTNGVEEESAESLPAEM |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (108-146) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10380 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Melanotropin alpha (Alpha-MSH) |
Mature Hormone Sequence | SYSMEHFRWGKPVGR |
Position of mature hormone in Pre-Hormone protein | 15 Residues from position (108-122) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10381 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Lipotropin beta (Beta-LPH) |
Mature Hormone Sequence | ELATNEVNHPQEDSALIQQKKKDGSYKMKHFRWSSPPAGKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ |
Position of mature hormone in Pre-Hormone protein | 74 Residues from position (149-222) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10382 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Lipotropin gamma (Gamma-LPH) |
Mature Hormone Sequence | ELATNEVNHPQEDSALIQQKKKDGSYKMKHFRWSSPPAG |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (149-187) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10383 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Melanotropin beta (Beta-MSH) |
Mature Hormone Sequence | DGSYKMKHFRWSSPPAG |
Position of mature hormone in Pre-Hormone protein | 17 Residues from position (171-187) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10384 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (190-222) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10385 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Met-enkephalin |
Mature Hormone Sequence | YGGFM |
Position of mature hormone in Pre-Hormone protein | 5 Residues from position (190-194) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10444 |
Swiss-prot Accession number | P18857 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain 2 precursor (Gonadotropin alphachain 2) (GTH-alpha). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 118 Amino acids |
Molecular weight | 13548 |
References | 1 PubMed abstract 3246480 |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain 2 |
Mature Hormone Sequence | YPRNYMNNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEFKQVLVNDIKLVNHTDCHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 95 Residues from position (24-118) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10631 |
Swiss-prot Accession number | P01235 (Sequence in FASTA format) |
Description | Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 144 Amino acids |
Molecular weight | 16040 |
References | 1 PubMed abstract 3246480 2 Chang Y.S., Huang F.-L., Lo T.-B.; Submitted (MAY-1991) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 607993 |
Domain Name | Cys_knot |
Hormone Name | Gonadotropin beta-II chain (GTH-II-beta) |
Mature Hormone Sequence | SYLPPCEPVNETVAVEKEGCPKCLVLQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFL |
Position of mature hormone in Pre-Hormone protein | 115 Residues from position (28-142) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10707 |
Swiss-prot Accession number | P42692 (Sequence in FASTA format) |
Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 45 Amino acids |
Molecular weight | 4979 |
References | 1 PubMed abstract 1475012 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS |
Position of mature hormone in Pre-Hormone protein | 45 Residues from position (1-45) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10734 |
Swiss-prot Accession number | P10298 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control |
Protein Length | 210 Amino acids |
Molecular weight | 23765 |
References | 1 PubMed abstract 2400791 2 PubMed abstract 2753359 3 PubMed abstract 2920175 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | DNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPAGKDETQKSSMLKLLRISFHLIESWEFPSQSLSGTVSNSLTVGNPNQLTEKLADLKMGISVLIQACLDGQPNMDDNDSLPLPFEDFYLTMGENNLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10828 |
Swiss-prot Accession number | P01335 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 108 Amino acids |
Molecular weight | 11821 |
References | 1 PubMed abstract 6306593 2 PubMed abstract 7037403 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | NAGAPQHLCGSHLVDALYLVCGPTGFFYNP |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (22-51) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10829 |
Swiss-prot Accession number | P01335 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 108 Amino acids |
Molecular weight | 11821 |
References | 1 PubMed abstract 6306593 2 PubMed abstract 7037403 |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVEQCCHKPCSIFELQNYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (88-108) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10996 |
Swiss-prot Accession number | O13050 (Sequence in FASTA format) |
Description | Gonadotropin subunit beta-1 precursor (Gonadotropin beta-I chain)(GTH-I-beta) (Follicle-stimulating hormone-like GTH). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 130 Amino acids |
Molecular weight | 14394 |
References | 1 Kobayashi M., Iwasaki M., Kondo H., Yoshiura Y., Watabe S.; "cDNA cloning of cyprinid gonadotropin I beta subunits."; Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases.
2 Kobayashi M., Iwasaki M., Kondo H., Yoshiura Y., Watabe S.; "cDNA cloning of cyprinid gonadotropin I beta subunits."; Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Cys_knot |
Hormone Name | Gonadotropin beta-I chain, GTH-I-beta |
Mature Hormone Sequence | GSECRSSCRLTNISITVESEECGSCITIDTTACAGLCKTQESVYRSPLMLSYQNTCNFREWTYETYEFKGCPARADSVFTYPVALSCECSKCNSDITDCGALSQQTLSCNAH |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (19-130) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11011 |
Swiss-prot Accession number | P09585 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23297 |
References | 1 PubMed abstract 3174460 2 PubMed abstract 2001405 3 PubMed abstract 3582956 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLNDLLERASQLSDKLHSLSTSLTNDLDSHFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKIPEDELLSLARSLLLAWSDPLALLSSEASSLAHPERNTIDSKTKELQDNINSLGAGLEHVFQKMGSSSDNLSSLPFYTSSLGQDKTSRLVNFHFLLSCFRRDSHKIDSFLKVLRCRAAKKRPEMC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11515 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPVGRKRRPIKVYTNGVEEESTETLPAEM |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (108-146) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11516 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Melanotropin alpha (Alpha-MSH) |
Mature Hormone Sequence | SYSMEHFRWGKPVGR |
Position of mature hormone in Pre-Hormone protein | 15 Residues from position (108-122) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11517 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Lipotropin beta (Beta-LPH) |
Mature Hormone Sequence | ELATNEIDYPQEEGALNQQDKKDGSYKMSHFRWSSPPASKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ |
Position of mature hormone in Pre-Hormone protein | 74 Residues from position (149-222) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11518 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Lipotropin gamma (Gamma-LPH) |
Mature Hormone Sequence | ELATNEIDYPQEEGALNQQDKKDGSYKMSHFRWSSPPAS |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (149-187) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11519 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Melanotropin beta (Beta-MSH) |
Mature Hormone Sequence | DGSYKMSHFRWSSPPAS |
Position of mature hormone in Pre-Hormone protein | 17 Residues from position (171-187) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |